MMVD
id Entry Entryname Proteinnames Genenames Organism Length Sequence
1 Entry Entry name Protein names Gene names Organism Length Sequence
2 O73557 Z_LASSJ RING finger protein Z,Protein Z(Zinc-binding protein) Z Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV) 99 MGNKQAKAPESKDSPRASLIPDATHLGPQFCKSCWFENKGLVECNNHYLCLNCLTLLLSV SNRCPICKMPLPTKLRPSAAPTAPPTGAADSIRPPPYSP
3 O09705 L_LASSJ RNA-directed RNA polymerase L, Protein L, EC 2.7.7.48,(Large structural protein) (Replicase) (Transcriptase) L Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV) 2,218 MEEDIACVKDLVSKYLVDNERLSRQKLAFLVQTEPRMLLMEGLKLLSLCIEVDSCNANGC EHNSEDKSVERILHDHGILTPSLCLWYPDGYKLTGNVLILLECFVRSSPANFEQKYIEDF KKLEQLKEDLKSVDINLIPLIDGRTSFYNEQIPDWVNDKLRDTLFSLLKYAQESNSLFEE SEYSRLCESLFMTSGRLSGVESLNVLMDNRSNHYEEVIASCHQGINNKLTAHEVKLQIEE EYQVFRNRLRKGEIEGQFLKVDKSQLLNELNNLYADKVVAEDNIEHLIYQFKRASPILRF LYANVDEGNEKRGNQTIGECQVQCWRSFLNKVKSLRILNTRRKLLLIFDALILLASKHDL MKQKCLKGWLGSCFLRVKDRLVSLEATKRDLEKWGERGNRLRSRITQSSQCLSKNQILNS IFQKTILKATTALKDVGISVDHYKIDMEVICLNSYDLIMDFDVSGVVPTISYQRTEEETF PYVMGDVELLGTTDLERLSSLSLALVNSMKTSSTVKLRQNEFGPARYQVVRCKEAYCQEF SLGNTELQLIYQKTGECSKCYAINDNKVGEVCSFYADPKRYFPAIFSAEVLQTTISTMIS WIEDCNELEGQLNNIRSLTKMILVLILAHPSKRSQKLLQNLRYFVMAYLSDYHHKDLIDK IREELITDVEFLLYRLIRTLMNLVLSEDVKSMMTNRFKFILNVSYMCHFITKETPDRLTD QIKCFEKFLEPKVRFGHVSTNPADTATEEELDDMVYNAKKFLSKDGCTTIEGPDYKRPGV SKKYLSLLTSSFNNGSLFKEREVKREIKDPLITSGSAALDLASKKSVVVNKYTDGSRILN YDFNKLTALAVSQLTEVFSRKGKYLLNKQDYEYKVQQAMSNLVLGSGQLKSDADGADLDE ILLDGGASDYFDQLKETVEKIVDQYREPVKLGSGPNGDGQPSINDLDEIVSNKFYIRLIK GELSNHMVEEFDHDILPGKFYEEFCNAVYENSRLKQKYFYCGHMSQCPIGELTKAVSTRT YFNHEYFQCFKSILLIMNANTLMGRYTHYKSRNLNFKFDMGKLSDDVRISERESNSEALS KALSLTNCTTAMLKNLCFYSQESPQSYDSVGPDTGRLKFSLSYKEQVGGNRELYIGDLRT KMFTRLIEDYFEAISLQLSGSCLNNEKEFENAILSMKLNVSLAHVSYSMDHSKWGPMMCP FLFLTVLQNLIFLSKDLQADIKGRDYLSTLLMWHMHKMVEIPFNVVTAMMKSFIKAQLGL RKKTKQSITEDFFYSNFQAGVVPSHISSILDMGQGILHNTSDFYALISERFINYAISCIC GGTIDAYTSSDDQISLFDQSLTELLQRDPEEFRTLIEFHYYMSDQLNKFVSPKSVIGRFV AEFKSRFFVWGDEVPLLTKFVAAALHNIKCKEPHQLAETIDTIIDQSVANGVPVHLCNLI QKRTLNPLQYARYPIDPFLLNCETDVRDWVDGNRSYRIMRQIEGLIPNACSKIRSMLRKL YNRLKTGQLHEEFTTNYLSSEHLSSLRNLCELLDVEPPSESDLEYSWLNLAAHHPLRMVL RQKIIYSGAVNLDDEKIPTIVKTIQNKLSSTFTRGAQKLLSEAINKSAFQSSIASGFVGL CRTLGSKCVRGPNKENLYIKSIQSLISDVKGIKLLTNSNGIQYWQVPLELRNGSGGESVV SYFRPLLWDYMCISLSTAIELGAWVLGEPKTVKVFDFFKHNPCDYFPLKPTASKLLEDRV GLNHIIHSLRRLYPSVFEKHILPFMSDLASTKMKWSPRIKFLDLCVALDVNCEALSLVSH IVKWKREEHYIVLSSELRLSHSRTHEPMVEERVVSTSDAVDNFMRQIYFESYVRPFVATT RTLGSFTWFPHKTSVPEGEGLHRMGPFSSFVEKVIHKGVERPMFKHDLMMGYAWIDFDIE PARFNQNQLIASGLVDPKFDSLEDFFDAVASLPPGSAKLSQTVRFRVKSQDASFKESFAI HLEYTGSMNQQAKYLVHDVTVMYSGAVSPCVLSDCWRLVLSGPTFKGKSAWYVDTEIINE FLIDTNQLGHVTPVEIVVDMERLQFTEYDFVLVGPCTEPTPLVVHRGGLWECGKKLASFT PVIQDQDLEIFVREVGDTSSDLLIGALSDMMIDRLGLRMQWSGVDIVSTLRAAAPSCEGI LSAVLEAVDNWVEFKGYALCYSKSRGKVMVQSSGGKLRLKGRTCEELTRKDECIEDIE
4 P08669 GLYC_LASSJ Pre-glycoprotein polyprotein GP complex, Pre-GP-C[Cleaved into:Stable signal peptide, SSP;Glycoprotein G1, GP1;Glycoprotein G2, GP2] GPC,GP-C Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV) 491 MGQIVTFFQEVPHVIEEVMNIVLIALSVLAVLKGLYNFATCGLVGLVTFLLLCGRSCTTS LYKGVYELQTLELNMETLNMTMPLSCTKNNSHHYIMVGNETGLELTLTNTSIINHKFCNL SDAHKKNLYDHALMSIISTFHLSIPNFNQYEAMSCDFNGGKISVQYNLSHSYAGDAANHC GTVANGVLQTFMRMAWGGSYIALDSGRGNWDCIMTSYQYLIIQNTTWEDHCQFSRPSPIG YLGLLSQRTRDIYISRRLLGTFTWTLSDSEGKDTPGGYCLTRWMLIEAELKCFGNTAVAK CNEKHDEEFCDMLRLFDFNKQAIQRLKAEAQMSIQLINKAVNALINDQLIMKNHLRDIMG IPYCNYSKYWYLNHTTTGRTSLPKCWLVSNGSYLNETHFSDDIEQQADNMITEMLQKEYM ERQGKTPLGLVDLFVFSTSFYLISIFLHLVKIPTHRHIVGKSCPKPHRLNHMGICSCGLY KQPGVPVKWKR
5 P13699 NCAP_LASSJ Nucleoprotein, EC 3.1.13.(Nucleocapsid protein) (Protein N) N Lassa virus (strain Mouse/Sierra Leone/Josiah/1976) (LASV) 569 MSASKEIKSFLWTQSLRRELSGYCSNIKLQVVKDAQALLHGLDFSEVSNVQRLMRKERRD DNDLKRLRDLNQAVNNLVELKSTQQKSILRVGTLTSDDLLILAADLEKLKSKVIRTERPL SAGVYMGNLSSQQLDQRRALLNMIGMSGGNQGARAGRDGVVRVWDVKNAELLNNQFGTMP SLTLACLTKQGQVDLNDAVQALTDLGLIYTAKYPNTSDLDRLTQSHPILNMIDTKKSSLN ISGYNFSLGAAVKAGACMLDGGNMLETIKVSPQTMDGILKSILKVKKALGMFISDTPGER NPYENILYKICLSGDGWPYIASRTSITGRAWENTVVDLESDGKPQKADSNNSSKSLQSAG FTAGLTYSQLMTLKDAMLQLDPNAKTWMDIEGRPEDPVEIALYQPSSGCYIHFFREPTDL KQFKQDAKYSHGIDVTDLFATQPGLTSAVIDALPRNMVITCQGSDDIRKLLESQGRKDIK LIDIALSKTDSRKYENAVWDQYKDLCHMHTGVVVEKKKRGGKEEITPHCALMDCIMFDAA VSGGLNTSVLRAVLPRDMVFRTSTPRVVL