MMVD
id Entry Entryname Proteinnames Genenames Organism Length Sequence
1 C5ILC4 C5ILC4_9VIRU Replicase, EC 2.7.7.48(Transcriptase) L Lujo mammarenavirus 2,234 MDSLKNELLQLISRNFPNDERLAPQKLKVLCQTEPKFIMIEGLKLLSTCIEIDICDENGC IHNTEEKSVELILRENGFVVPSLPCVTPDGFKVSGNMLILLECFVRLNPLEYEQKYNNDM KKLSSLRGDLEHSGITLVPLVVGRSGYENNSIPDWVVFKFKNLIFRLLEYVQENEAMLEE SEYIRLSESLKGNGSKLFDLDAFNLLKNNSGEHFENIMRLCVEGVRPDIPLSEVNSKIVE NFLEFKAKLKKGVIPPLFMMTDKERLLKEFCDLYLDQGVSSAPESKWELLRDFKEATSFT NFIYFDSKNDEGHPEQDKAEKVGNDRHYHRKSCGMISMLNKSKSIKLMNTRRKLLLGLDV VRLSHLISLKNEFPRGDDDESVWCGQSFTTVSDRLVSVMSTQRDLKKHLFRLSRMPKNKS KGKTKALNEIFLDYRRLILNKVFNSLNAHGLTAHSYGLEASDFENWPSLEDFMSFKKSGS IPVMNYERDNFRPQMHLDETSFSEDITDLRMISSLSLSLVNSMKTSSVSKIRQNASGKNR YGRVSCEECFFQEIKSPKGTFTLIYQKTGESSKCYSINRDGEHICSFYADPKRYFLPIMS SEVIKGVIDTMVQWLSDVKELEGCIDEIKILLKIIFMSVLLNPSKRSQKFLQNLRYFIMA FFGLAHHVDLMEKVKEDLITKSEYLIYRCVRKVMILVLGDSVETMLTSRFKFLLNLSYIC HFITKETPDRVTDQIKCFEKFLEPKLKFKSVFVNPKNDVTKEESSLLLESGSRFLNKDEF DVKAPGVSKQMLSLMLSFVNSTSGFTPDELAKIKTNPLKDARCSTALDLSSNKSVVIPKT DDKGNSVDYDYDKLVGVSLCDIVEKFHNKTKFCLSPEQLEYKILKSISHTMAEENRKEKK KKTTTRDSQTSVSESIDLEESEDSVPLEELLPSESLSKIRCSIDKIFSKYQHKQNPKKVQ DTEGISVSEALRDLVANHRDRNLILSEVSYHLVEDFEESLFPDSFYEDFCERVGNSPKYS KLVMTETVLESCPIEMFTKNITRKFYEEGDWFKCFKTILLQLNVNHYSGRFKHNSRLRLN YKFDYKKLYEDARISERESNSEAMCKLLSFTKCITSTLKNLCFYSDESPTSYNGAGPDTG RLQFSLSYKEQVGGNRELYIGDMKTKMYTRFVEDFFESLTGQLNGSCLNDEAQFEEAISE MKQCIREGNLSYNMDHSKWGPTMCPLLFLTVLKNIKYIKDFDKPIEHISTLLSWHVHKYV EVPFNVINAITKSFVKRQLGIQQGVINTKTEEFIFSHLDHGIVPSHISSILDMGQGILHN ASDYYGLITEKFINYTLKLLFRGELKSFTSSDDQISLFDKELSATLRDDTEELLCFLNYH YYLSSQLNKFVSPKSSLCEFVAEFKSRFFVWGEEVPLLTKFVAASLHNVKCKTPHQLSET VDTIVDQCAANGVPINICNLLQKRCINLLRYCRFPINPFLLNVNTDIKDWIDGTRGYRIQ RQLENLFPDSTGTVRKLVRRLYNSLKNDEVREDFLAELFSRDPFTVLKSLFKHYDLDEPQ LRDCWLNLEAHHPIRMVLRQKVLFPSALQIESVNLPTVIRVLQNKLSHSFTKSTQKLLSD SVNKSAFQSSVASGFIGLAKTIGSKCVRDADRNCHYIVEILSKLESLPGLKVIMKDDILI VELESEDGSIQSDWPPECEWLRPMIRPILIDYLCIVLSNCLELGTWVLGDPEPPQRGPFL GRSSHDYVAVFPVKSAVLEDKVGYNHILQSVRRLYPSLFETHLLPFLDDNSLRKSSWAPK IRFLDLCVSLDITCEAISLISHVVKWKRSEQYTVLTLDLSNSHNRKFTTMIDSKVISTSD TCINFLKQLFFESLIRPVLLSSRTLGSFTWFPHASMMPKGEGAPSLGPFENFVLKTIHKG QERPMYRDDLSSGFSWIDLKDFKAYISSAHQRISRVSSADAGRDCFNLDERVVITITHNF IKRNRNGACDSKFSIIHRIHGSVSDASEGFLMVEVLGVECGFSGAVRDEFVRTNILAIAR SLSFSKEDMTVFVQRQMIDQHEEPSNQDTIMVELIPGESFSVDDPLAYTRLGPDWVPVGL VLIDGDVKELKETVAQLKVSLDTKDVMIFLAELYPEHMALIKKGIETMLKKSQKHEVDLS RVDLIKCFKDVGLTEHDLVDCFSGVIGWVKLSSYTLAYSKHLKDLVIAHPGGGMRLGGVC CRLLREGTSTIEIE
2 C5ILC2 C5ILC2_9VIRU Nucleocapsidprotein(Nucleoprotein) N Lujo mammarenavirus 558 MSQSKEVKSFLWLQTLRRELSPFCTDVRAKVVKDAVSLINGLDFSMVSDVQRLMRKDKRN DEDLMKLRELNQTVDGLVDLKSSNKKNRVGVGKLTSDELMILATDLEKLKKKVTRTEARG PGVYRGNLSQDQLGRRSELLNMIGMGTPRPTRNTVVRVWDVKDSSLLNNQFGTMPSLTLA CLTRQTRVDLNDSVQACVDLGLIYTAKFPNMDDLDKLKNKHPVLDYVSNCDSAINISGYN LSLASLVKAGASLMKGGDMLETIELNSRNIDDVIKATLTARNKVQMFVSEVPGERNPYEN LLYKICLSGEGWPYISSRTSIKGRSWDNTVIDMTPKDPTPPQNERAKAPHQFPVGVSFSQ SQLLDDIMKNLNPKGRTWMDIEGRPDDPVEIAIFQPEERLCLHFYREPTDQKQFKNDSKY CHGMDFTQLCSTQPGLTTAVLERLPLGMVITCQGKDDIEKLLHSQGRRDVKFIDIQMSKE ASRKFEDQVWDSYKTFCNQHTGIVVTKSKKGKKEITPHCALMDCIMYESAVNGQLYQEPI RNLLPADMIFRTAAKLSL
3 C5ILC3 C5ILC3_9VIRU Multifunctional matrix-like protein (Z protein) Z Lujo mammarenavirus 95 MGQRHSSGSGQPNPKPSDSDHEARRSELHSDASHLGPLNCKSCWKSKKALVKCYDHYLCL NCLSLLMGITPRCPFCYRELPKNLDLAEAPSAPPL
4 C5ILC1 C5ILC1_9VIRU Glycoprotein Lujo mammarenavirus 454 MGQIVAVFQAIPEILNEAINIVIIVIIMFTLIKGVFNLYKSGLFQLVIFLLLCGKRCDSS LLSGFNLETVHFNMSLLSSIPMVSEQQHCIQHNHSSITFSLLTNKSDLEKCNFTRLQAVD RVIFDLFREFHHRVGDFPVTSDLKCSHNTSYRVIEYEVTKESLPRLQEAVSTLFPDLHLS EDRFLQIQAHDDKNCTGLHPLNYLRLLKENSETHYKVRKLMKLFQWSLSDETGSPLPGGH CLERWLIFASDIKCFDNAAIAKCNKEHDEEFCDMLRLFDYNKASIAKLRGEASSSINLLS GRINAIISDTLLMRSSLKRLMGIPYCNYTKFWYLNHTKLGIHSLPRCWLVSNGSYLNETK FTHDMEDEADKLLTEMLKKEYVRRQEKTPITLMDILMFSVSFYMFSVTLCICNIPTHRHI TGLPCPKPHRLRKNGTCACGFFKSINRSTGWAKH
<