MMVD
id Entry Entryname Proteinnames Genenames Organism Length Sequence
1 Q6UY73 Q6UY73_JUNIN Pre-glycoprotein polyprotein GP com... GPC Junin mammarenavirus (JUNV) (Junn mammarenavirus) 485 MGQFISFMQEIPTFLQEALNIALVAVSLIAIIKGIVNLYKSGLFQFFVFLALAGRSCTEE AFKIGLHTEFQTVSFSMVGLFSNNPHDLPLLCTLNKSHLYIKGGNASFQISFDDIAVLLP QYDVIIQHPADMSWCSKSDDQIWLSQWFMNAVGHDWHLDPPFLCRNRTKTEGFIFQVNTS KTGVNENYAKKFKTGMHHLYREYPDSCPNGKLCLMKAQPTSWPLQCPLDHVNTLHFLTRG KNIQLPRRSLKAFFSWSLTDSSGKDTPGGYCLEEWMLVAAKMKCFGNTAVAKCNLNHDSE FCDMLRLFDYNKNAIKTLNDETKKQVNLMGQTINALISDNLLMKNKIRELMSVPYCNYTK FWYVNHTLSGQHSLPRCWLIKNNSYLNISDFRNDWILESDFLISEMLSKEYSDRQGKTPL TLVDICFWSTVFFTASLFLHLVGIPTHRHIRGEACPLPHRLNSLGGCRCGKYPNLKKPTV WRRGH
2 Q6UY72 Q6UY72_JUNIN Nucleoprotein N Junin mammarenavirus (JUNV) (Junn mammarenavirus) 564 MAHSKEVPSFRWTQSLRRGLSQFTQTVKSDVLKDAKLIADSIDFNQVAQVQRALRKTKKG EEDLNKLRDLNKEVDRLMSMRSVQRNTVFKVGDLGRDELMELASDLEKLKNKIRRAETGS QGVYMGNLSQSQLAKRSEILRTLGFQQQGTGGNGVVRIWDVKDPSKLNNQFGSVPALTIA CMTVQGGETMNSVIQALTSLGLLYTVKYPNLSDLDRLTQEHDCLQIVTKDESSINISGYN FSLSAAVKAGASILDGGNMLETIRVTPENFSSLIKSTIQVKRREGMFIDEKPGNRNPYEN LLYKLCLSGDGWPYIGSRSQITGRSWDNTSIDLTRKPVAGPRQPEKNGQNLRLANLTEIQ EAVIREAVGKLDPTNTLWLDIEGPATDPVEMALFQPAGKQYIHCFRKPHDEKGFKNGSRH SHGILMKDIEDAMPGVLSYVIGLLPPDMVVTTQGSDDIRKLFDLHGRRDLKLVDVKLTSE QARQFDQQVWEKYGHLCKYHNGVVVNKKKREKDTPFKLASSEPHCALLDCIMFQSVLDGK LYEEEPTPLLPPSLLFLPKAAYAL
3 Q6UY75 Q6UY75_JUNIN RING finger protein Z Z Junin mammarenavirus (JUNV) (Junn mammarenavirus) 94 MGNCNGASKSNQPDSSRATQPAAEFRRVAHSSLYGRYNCKCCWFADTNLITCNDHYLCLR CHQGMLRNSDLCNICWKPLPTTITVPVEPTAPPP
4 Q6UY74 Q6UY74_JUNIN RNA-directed RNA polymerase L L Junin mammarenavirus (JUNV) (Junn mammarenavirus) 2,210 MEESVNEIKSLIRKHFPERQELAYQRDIFLSQHHPSSLLLEGFKLLSSLVELESCEAHAC QINSDQKFVDVILSDHGILCPTLPKVIPDGFKLTGKTLILLETFVRVNPDEFERKWKSDM SKLLNLKSDLLRAGITLVPVVDGRSSYSNRFLADWVVERVRWLLIDILKKSKFMQEINIE EQEYQRLIHSLSNTKNQSLGLENIECLKKNSLGYDERLNESLFVGVRGDIRESVIREELI KLRFWFKKEIFDKQLGKFKFSQKSKLINDLILLGSHKDSDVPSCPFCANKLMDVVYSIAL HPIDEVNMESQSDENSISIDAVERCYLQALSVCNKVKGLKVFNTRRNTLLFLDLVLLNLL CDLFKTHDDAIVRLRNAGIVVGQMLMLVNDRLLDILEAIKLIRKKLMTSPKWVQVCSRTL KNSHQDLWSQLEKLIKHPDMDSLMILAQALVSDRPVMRYTIDKEFEKICRHQPFSSLVEG EQKKLFRILSSISLALVNSMKTSFSSRLLINEREYSRYFGNVRLRECYVQRFHLTKNTFG LLFYQKTGEKSRCYSIYLSINGVLEEQGSFYCDPKRFFLPIFSEDVLIEMCEEMTSWLDF SHELMTMTRPILRLLVLAVLCSPSKRNQTFLQGLRYFLMAYANQIHHVDLMSKLRVDCMS GSEVLIQRMAVELFQTILGEGEDADLYFARRFKYLLNVSYLCHLVTKETPDRLTDQIKCF EKFIEPKVKFDCVVVNPPLSGSLTLEQEDTMIRGLDRFFSKEAKTSSDTQIPGVCKEILS FCISLFNRGRLKVTGELKSNPYRPNITSTALDLSSNKSVVIPKLDELGNILSVYDKEKLV STCVSTMAERFKTKGRYNLDPDSMDYLILKNLTGLVSTGSRTRTNQEELSVMYESLTEDQ VRAFEGIRNDVQMTLAKMANSEGTKVEITKLKSKNLSVDERESLESLWAPFGVLREIKAE VSMHEVKDFDPDVLRSDVYKELCDAVYLSPFKLTYFLEAPQDICPLGLLLKNLTTIAYQE DEFFECFKYLLIQGHYDQKLGSYEHRSRSRLGFSSEVLRLKDEVRLSTRESNSEAIADKL DKSYFTNAALRNLCFYSDDSPTEFTSISSNTGNLKFGLSYKEQVGSNRELYVGDLNTKLM TRLVEDFSEAVGSSMRYTCLNSEKEFERAICDMKMAVNNGDLSCSYDHSKWGPTMSPALF LSFLYTLELKNPRDRTKVNLEPVMNILKWHLHKVVEVPINVAEAYCVGKLKRSLGLMGCD CTSVGEEFFHQYLQSRDQVPSHIMSVLDMGQGILHNTSDLYGLITEQFLCYALDLLYDVI PVTYTSSDDQVSLIKIPCLSDEKFQDRTELLEMVCFHEFLSSKLNKFISPKSVIGTFVAE FKSRFFVMGEETPLLTKFVSAALHNVKCKTPTQLSETIDTICDQCIANGVSTHIVSKISI RVNQLIRYSGYRETPFGAIEEQDVKDWVDGSRGYRLQRKIEAIFSDDKETMFIRNCARKV FNDIKRGKIFEENLINLISRGGDEALSGFLQYAGCSEDEIRQTLDYRWVNLASFGDLRLV LRTKLMTSRRVLEKEEMPTLIRTIQSRLSRNFTKGVKKILAESINKSAFQSSVASGFIGF CKSMGSKCVRDGKGGFLYIKDIFTRIMPCLCGICERKPKVIYCQKSLKEVNQFSKPILWD YFSLVLTNACELGEWVFSAIKSPQAPLVLCNKNFFWAVKPKAVRQIEDQLGMNHVLHSIR RNYPKLFEEHLAPFMNDLQVNRSLDSGRLKFLDVCVALDMMNENLGIISHLLKVRDNNVY IVKQSDCASAHVRQSEYTNWEVGISPQQVCRNFMVQVVLSSMINPLVMSTSCLKSFFWFN EVLDLEDDSQVDLAELTDFTLSIRNNKVSRAMFVEDIAMGYVVSSFDNIKVFLEGVSVDN ISLLPQEDMMDLHTVLRNVACQEAVKLKLIIQVEHTRVSTKFKLRRKMVYSYTIVSSLGV DDVGTPELELNVDAMSQCVSGSEGSHSLLDGALVIASLPLFTGHESFDLAGLFIDAGYAA TNDDNILSHVKFNFGDFYSELSNKYAYDLIGPDNPGEPLVLKEGIFYRGNERLSTYRVEL SGDVIVKAIGALEDIDSVETLLSQLWPYLKTTSQTILFQQEDFVLVYDLHKEQLIRSLDK FGDWLEFSNFKVAFSRSLNDLLISDPQGQFRLKGVTCRPLKHKVEIKDID