MMVD
id Entry Entryname Proteinnames Genenames Organism Length Sequence
1 B2C4J0 GLYC_CHAVB Pre-glycoprotein polyprotein GP complex, Pre-GP-C GPC,GP-C Chapare mammarenavirus (isolate Human/Bolivia/810419/2003) 484 MGQLVSFFQEIPNIIQEAINIALIAVSLIAILKGLVNLWKSGLFQLLVFLILAGRSCSFK IGRSTELQNITINMLKVFEDHPISCTVNKTLYYIRESENATWCVEIAALDMSVLLSPHDP RVMGNLSNCVHPDIKHRSELLGLLEWILRALKYDFLNYPPLLCEKVTSSVNETRIQINVS DSAGSHDFKETMLQRLAILFGTKLMFDKTPKQFIVIRNQTWVNQCKSNHVNTLHLMMANA GHAVKLRRLQGVFTWTITDAAGNDMPGGYCLERWMLVTSDLKCFGNTALAKCNLNHDSEF CDMLKLFEFNKKAIESLNDNTKNKVNLLTHSINALISDNLLMKNRLKELLDTPYCNYTKF WYVNHTITGEHSLPRCWMVKNNSYLNESEFRNDWILESDHLLSEMLNKEYFDRQGKTPIT LVDICFWSTLFFTTTLFLHLVGFPTHRHIQGEPCPLPHKLNSNGGCRCGRYPELKKPTTW HRKH
2 B2C4J3 L_CHAVB RNA-directed RNA polymerase L, Protein L L Chapare mammarenavirus (isolate Human/Bolivia/810419/2003) 2,208 MDTFLLELKDLVRKYVPELVELSFQKDALLSQVHPRLVLVEGFKLLSLLVELESCKVNAC RHNFEQKFVDVILSDHGVICPTLPKVTPDGFNLMGKTLILLETFVRVNPNDFERKWKADM SKLMSLKDDLARVGITMVPVVDGRGSYNTSYLPEWATERLRWLLIEILKGVKATSEIEIE DQEYQRLIHSLAKANNQSMGFENLEFLKRRLLSYDQLLDTSLLVGIRNDVRESKIIEELI KIKLWYKTEIFNKGLGKFKRTNKSNLLSDLLKIGLHQDSDTINCMFCSCKILELCYTLSN KLSIDHSKEEMKDDEVGGKQPVCISYSSLLSICNKIKGSKIFNTRRNTLLFLDLIMLNFI VDEMIQDDSVVDSLRGAGFIIGQMVVLVNDRALDILAAMKLIRHKLGNSKDWLSVCGKVL KRYDEEMWKEVKTYIKEPDFDMLFQLAKSLVSERPIMRYTVHKDNESRCLHQNSLNISDQ SFKAMLKALSHVSLSLINSMKTSFSSRLLINEKDYSRYYGNVRLKECYVQRFPISSRVTG YLFYQKTGERSRCYSLYISENGELSELGSFYCDPKRFFLPVFSEDTIVSMCNEMVCWLDF DEQLVELVKPKLRSLVLLLLCSPSKRNQTFIQGLRYFIMAYANQAHHVDLMSKLEIECKS SSEIQLQRLAVTLFELVLSTGDDKDFGFARRFKFLLNISYLCHFVTKETPDRLTDQIKCF EKFLEPKLNFNSVIVNPSLSGILTEAQEEIMTSSVNRFFQKNLTNISDVKEPGVSKELIS FCVSLFNRGKLRVSGDLKVDPFRPSFTSTALDLSSNKSVVVPKLDELGNALSKYDKQMMI SSCVTTLTEMFKTKGRYNLDPDSLDFLVLKNLSNLVSVSVSKGQMKEELSLLYDTLSEEQ LESFEQIKQDVQLTLSRMKESKCNNVGLGNSRKVNKHLSKSELLETLWSPYQVLRAIKNE VSIHEIKDFDPDIIEHETVKKLCDEVYQSSNKLEFFLEEPLKSVPLEFLLKNLTTIAYEE TDYLECFKYLLIQGGFDQKLGSYEHKSRSRLGLSSEALRVQEDARVSTRESNAEAIAKKL DKTFFTSAALRNLCFYSEDSPTEFTSVSTNTGNLKFGLSYKEQVGSNRELYVGDLNTKLM TRLVEDFSEMITSSMRYSCLNSEKEFERAICDMKMAVNNGDISMSLDHSKWGPHMSPALF YSFLANLNLTEPKSRAKLNLGPLLDILKWHLHKVVEVPFNVAQAYCVGKIKRSLGLMECQ TSSVTEQFYHNFLQRENEIPSHIMSVLDMGQGILHNLSDLYALITEQFLNYAIYKLYDVD VLSYTSSDDQISIMKLPAYEHIDEDSPDWLEIVCFHEYLSSKLNKFVSPKSVVGNFVAEF KSRFFVMGEETPLLTKFVAAALHNVRCKTPTQLAETVDTICDQCVANGVSVSIVSKISER VNRLVKYSGFGETPFLSVVKQDVKDWSDGSRGYRLQRNIENSLRDSKILEVMRKGARKVF LGIKNGRIFEENLIGLIGRGGDEALRGFLLYAEVDKDEIENALRYRWVNTSTFGDLRLVL RTKIMSSKRVLERESIPSLVKTLQSRMSKNFTKGAKKILAESINKSAFQSSVASGFIGFC KSMGSKCVRDGSGGFIYLKDIYKKITTCECKHCSVWRGVVYCEKSVEKIFQFTRSIMWDY FTLVLTNACELGEWVFSSVKLPTKATILDNPNLFWAIKPRTHKHIEDRLGLNHILHSIKK NYPQLFEEHLAPFMSDLQSNQMINPSKIKFLDICVALDMVNENLGIIGHLLRGRNNTIYI VKQSECAGAHVRQADYVDQDLGLSPQQICYNFKVQFLLSSMINPLIVSTSTLRSFFWFNE VLSIEEDDQIELGELTDFTLSIKTYNLERAMTLDDMTMGYVCSTLLDEVVSLESLDSCQD LAALQFKRQDLSDFFRDLGEDFVKVGLNIQIVHQRRSTKFDISRKVVYTFRILLLINLSE HLREEVKIPVQSLSLYASGAGNNHLFLDGVSMIPTLPLFNGSKSVNLAKVLIEHELATSN DFKLLECVIMDFSNFLDELRDKYSYVLVGPEEQENPIVFQNGAFMADNQKLSYMRVEIFG DTIVKALGALETDREIENLLCNLWPYLKSIKKTIDFNQADFEMIYDLHRTALLKSLCQMD SWIEFTSFSVAYSKHLQDLVVSDNLGNLRLKGITCRPFRRDQCIQEIE
3 B2C4J1 NCAP_CHAVB Nucleoprotein,(Nucleocapsid protein) (Protein N) N Chapare mammarenavirus (isolate Human/Bolivia/810419/2003) 562 MSNSKEIPSFRWTQSLRRELSSFTIPVKSDVLKDAKMIADGLDFSQVALVQRVLRKTKRT DGDLDKLRDLNREVDNLMAMKSAQKNTILKLGDLNKSELMDLASDLEKLKKKVGQTERSP VGGVYLGNLSQSQLSKRTDLLRRLGFQQPQVRSTGVVRIWDVADPTRLNNQFGSVPALTI ACMTVQGGDTMGNVVQALTSLGLLYTVKFPNLADLEKLAAEHDCLQIITKDESAINISGY NFSLSAAVKAGATFLDGGNMLETIKVTPDNFSTIIKTVLGVKKRENMFIDERPGNRNPYE NLLYKLCLSGEGWPYIGSRSQVKGRSWENTTVDLSLKPTQGPKAPEKVGLNVRLSHLTEI QESVVREAMSKINPSHTTWIDIEGTSNDPVELALYQPESGNYILCYRKPHDEKGFKNGSR HSHGMLLKDLESAQPGLLSYIIGLLPQDMVLTAQGSDDIKRLLDTHGRKDLKVVDVKLSS DQARNYEEQVWSDFGHLCKKHNGVVVPKKKKDKDPSQSTEPHCALLDCLMFQSVIDGQPP QIKLQSLLPEVLLFTMKPAFAI
4 B2C4J2 Z_CHAVB RING finger protein Z, Protein Z(Zinc-binding protein) Z Chapare mammarenavirus (isolate Human/Bolivia/810419/2003) 98 MGNTKTKDRQYQSNSSQPTNTSAPVLLRRQAEPSLYGRHNCRCCWFADTNLVNCSNHYLC LKCLNTMLRRSNLCDICGEELPTTIIVPVEPSAPLPGQ