MMVD
id Specie Name Protein Name Sequence (Adjuvant + Construct)
1 LASV Protein Z MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKGLVECNNHYGPGPGPTKLRPSAAPTAPPTGPGPGQFCKSCWFENKGLVEKKCKSCWFENKGLVECNNKKAKAPESKDSPRASLIPKKMPLPTKLRPSAAPTAP
2 LASV Protein L MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKITDVEFLLYAAYLIDGRTSFYAAYQTEPRMLLMGPGPGYQFKRASPILRFLYAGPGPGILVLILAHPSKRSQKKKYDLIMDFDVSGVVPTIKKVVSYFRPLLWDYMCISKKTKFVAAALHNIKCKEP
3 LASV Protein G MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKMTSYQYLIIAAYAAYNWDCIMTSYAAYFSRPSPIGYGPGPGSKYWYLNHTTTGRTSGPGPGDHALMSIISTFHLSIKKWDCIMTSYQYLIIQNTKKLSDSEGKDTPGGYCLTKKYLIIQNTTWEDHCQFS
4 LASV Protein N MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKALTDLGLIYAAYYENAVWDQYGPGPGGRKDIKLIDIALSKTGPGPGGWPYIASRTSITGRAKKQFKQDAKYSHGIDVTDKKYIASRTSITGRAWENTKKGVVRVWDVKNAELLNN
5 CHAPV Protein G MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKESENATWCVAAYSTELQNITIGPGPGLVFLILAGRSCSFKIGPGPGHAVKLRRLQGVFTWTKKLEWILRALKYDFLNYPKKAGSHDFKETMLQRLAIKKLMFDKTPKQFIVIRNQ
6 CHAPV Protein L MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKMADNQKLSYAAYFTRSIMWDYGPGPGRYFIMAYANQAHHVDGPGPGSCKILELCYTLSNKLKKHSKEEMKDDEVGGKQPKKHVRQADYVDQDLGLSPKKKDEIENALRYRWVNTS
7 CHAPV Protein N MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKESGNYILCYGPGPGLNNQFGSVPALTIACGPGPGNISGYNFSLSAAVKAKKFSTIIKTVLGVKKRENKKKGRSWENTTVDLSLKPKKAKMIADGLDFSQVALV
8 CHAPV Protein Z MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKNTKTKDRQYGPGPGKDRQYQSNSSQPTNTGPGPGSAPVLLRRQAEPSLYKKQAEPSLYGRHNCRCCWKKCRCCWFADTNLVNCSNKKTKTKDRQYQSNSSQPT
9 LUJV Protein L MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKCLSPEQLEYAAYKLSSYTLAYGPGPGKYVEVPFNVINAITKGPGPGKSIKLMNTRRKLLLGKKCGMISMLNKSKSIKLMKKKQCIREGNLSYNMDHSKKLQLISRNFPNDERLAP
10 LUJV Protein N MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKCTDVRAKVVAAYACVDLGLIYGPGPGFLWLQTLRRELSPFCGPGPGEGWPYISSRTSIKGRKKYISSRTSIKGRSWDNTKKDDVIKATLTARNKVQMKKAVLERLPLGMVITCQG
11 LUJV Protein Z MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKHSDASHLGPGPGPGCKSCWKSKKALVKCYGPGPGLCLNCLSLLMGITPRKKSDASHLGPLNCKSCWKKKCKSCWKSKKALVKCYDKKVKCYDHYLCLNCLSLL
12 LUJV Protein G MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKILMFSVSFYAAYHSSITFSLLGPGPGEAINIVIIVIIMFTLGPGPGTKFWYLNHTKLGIHSKKHSSITFSLLTNKSDLEKKLSDETGSPLPGGHCLEKKLPCPKPHRLRKNGTCA
13 GTOV Protein L MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKTTDFTRLRYGPGPGDCFKYILIQAGFDQRGPGPGLWPFIRINNLKVKMAKKGFMYIREVLNKQRVCPKKEYTCISPNVGNLKFGL
14 GTOV Protein Z MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKCSDHYLCLRGPGPGRTAIHSLYGRYNCKCGPGPGCKCCWFADKNLIKCSKKTAIHSLYGRYNCKCCWKKYGRYNCKCCWFADKNL
15 GTOV Protein G MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKLSDPKGNDMGPGPGAGVAGLITGGRRTRRGPGPGFLRATTELRTFSILNKKTQCIKGSPEFDWILGWKKLGWTIKGLGHDFLRDP
16 GTOV Protein N MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKPTDPVELAVGPGPGNISGYNFSLSAAVKAGPGPGAGILRTLGFQQQRGAKKCMTVQGGETMNNVVQAKKWMDIEGPPTDPVELAV
17 JUNV Protein G MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKHTEFQTVSFGPGPGGKLCLMKAQPTSWPLGPGPGEEWMLVAAKMKCFGNKKYDVIIQHPADMSWCSKKKLCLMKAQPTSWPLQCP
18 JUNV Protein N MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKATDPVEMALGPGPGKEVPSFRWTQSLRRGGPGPGNISGYNFSLSAAVKAKKAKLIADSIDFNQVAQVKKLYTVKYPNLSDLDRLT
19 JUNV Protein Z MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKNLITCNDHYGPGPGAAEFRRVAHSSLYGRGPGPGPAAEFRRVAHSSLYGKKSRATQPAAEFRRVAHSKKLCNICWKPLPTTITVP
20 JUNV Protein L MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKNLDPDSMDYGPGPGRYFLMAYANQIHHVDGPGPGKSAFQSSVASGFIGFKKVSLIKIPCLSDEKFQDKKLGEGEDADLYFARRFK
21 MACV Protein Z MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKNLITCNDHYGPGPGSAEFRRTAPPSLYGRGPGPGNCKCCWFADTNLITCKKLCHICWKPLPTSITVPKKTAPPSLYGRYNCKCCW
22 MACV Protein L MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKNLDPDSTDYGPGPGRYFLMAFANQIHHIDGPGPGGQMVMLVNDRVLDILKKSIRRNYPVLFDEHLTPKKKNLGRADNSVKNGNNP
23 MACV Protein G MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKVSDISVLMKGPGPGEEWMLIAAKMKCFGNGPGPGWLIRNGSYLNTSEFRKKDVSIYEPEDLGNCLNKKKDWLMDPPMLCRNKTKK
24 MACV Protein N MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKLTSDQARLYGPGPGKEIPSFRWTQSLRRGGPGPGNISGYNFSLSAAVKAKKLDCIMYQSVMDGKMVDKKLYTVKYPNLNDLDKLT
25 SABV Protein L MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKMIDNQKLSYGPGPGQMILLVNDRVLDILTGPGPGWTTERLRWLLIEVLKKKEIEYGFTRRFKFLLNIKKAMENFTDDDFKIMLKA
26 SABV Protein Z MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKCSDHYICLKGPGPGKQVAILKRQAEPSLYGPGPGKCLNIMLGKSSFCDIKKQAEPSLYGRHNCRCCWKKPTSIVVPIEPSAPPPE
27 SABV Protein G MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKSTELQNITFGPGPGKFWYVNHTASGEHSLGPGPGALIAVSLIAALKGMIKKEFRNDWIIESDHLLSEKKNSTWKNQCEMNHVNSM
28 SABV Protein N MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKPEAAKQSDNTMGDVGPGPGKEIPSFRWTQSLRRGGPGPGLNNQFGSVPALTIACKKARKFEEPIWSDFGHLCKKAKMILDGLDFNQVSLV