MMVD
id Entry Entryname Proteinnames Genenames Organism Length Sequence
1 Q6UY77 Q6UY77_MACHU RING finger protein Z Z Machupo virus (MACV) 94 MGNCNKPPKRPPNTQTSSNQPSAEFRRTAPPSLYGRYNCKCCWFADTNLITCNDHYLCLR CHQTMLRNSELCHICWKPLPTSITVPVEPSAPPP
2 Q6UY76 Q6UY76_MACHU RNA-directed RNA polymerase L L Machupo virus (MACV) 2,209 MDEYVQELKGLIRKHIPERCEFGHQKVTFLSQVHPSPLLTEGFKLLSSLVELESCEAHAC QANTDQRFVDVILSDNGILCPTLPKVIPDGFKLTGKTLILLETFVRVNPDEFEKKWKADM SKLLNLKHDLQKSGVTLVPIVDGRSNYNNRFVADWVIERIRWLLIGILKASKSMLEIDIE DQEYQRLIHSLSNVKNQSLGLENLEHLKRNSLDYDERLNESLFIGLKGDIRESTVREELI KLKLWFKDEVFSKGLGKFKLTDRRELLESLSSLGAHLDSDVSSCPFCNNKLMEIVYNVTF SCVERTDGVATVDQQFSTTHSNIEKHYLSVLSLCNKIKGLKVFNTRRNTLLFLDLIMVNL MVDISDSCQDAIESLRKSGLIVGQMVMLVNDRVLDILEAVKLIRKKIGTNPNWVKNCSKI LERSHPEIWHHLSTLIKQPDFNSLISIAQHLVSDRPIMRYSVERGSDKICRHKLFQEMSS FEQMRLFKTLSSISLSLINSMKTSFSSRLLVNEREFSKYFGNVRLRECYAQRFYLAESLV GFLFYQKTGERSRCYSVYLSDNGVMSEQGSFYCDPKRFFLPVFSDEVLAGMCEEMTSWLD FDTGLMNDTGPILRLLVLAILCSPSKRNQTFLQGLRYFLMAFANQIHHIDLTSKLVVECK SSSEVVVQRLAVGLFIRLLSGESDASLFFSRRFKYLLNVSYLCHLITKETPDRLTDQMKC FEKFIEPKVKFGCAVVNPSLNGKLTVDQEDIMINGLKKFFSKSLRDTEDVQTPGVCKELL NYCVSLFNRGKLKVSGELKNNPFRPNITSTALDLSSNKSVVIPKLDELGNILSTYDKEKL VSACVSSMAERFKTKGRYNLDPDSTDYLILKNLTGLVSAGPKAKSTQEELSLMYEALTEE QVESFNEIKHDVQVALAKMADNSVNTRTKNLGRADNSVKNGNNPLDNLWSPFGVMKEIRA EVSLHEVKDFDPDVLPPEVYKELCDAVYKSSEKCNFFLEGVLDVCPLGLLLKNLTTSSYV DEEYFMCFKYLLIQGHFDQKLGSYEHKSRSRLGFTDETLRLKDEVRLSIRESNSEAIADK LDKSYFTNAALRNLCFYSEDSPTEFTSISSNSGNLKFGLSYKEQVGSNRELYVGDLNTKL MTRLVEDFSEAVGNSMKYTCLNSEKEFERAICDMKMAVNNGDLSCSYDHSKWGPTMSPAL FLALLQMLELRTPVDRSKIDLDSVKSILKWHLHKVVEVPINVAEAYCIGKLKRSLGLMGC GSTSLSEEFFHQTMQLNGQIPSHIMSVLDMGQGILHNTSDLYGLITEQFLCYALDLLYDV IPVSYTSSDDQITLIKTPSLDIEGGSDAAEWLEMICFHEFLSSKLNKFVSPKSVIGTFVA EFKSRFFVMGEETPLLTKFVAAALHNVKCKTPTQLSETIDTICDQCIANGVSTKIVTRIS KRVNQLIRYSGYGETPFGAIEDQDVKDWVDGSRGYRLQRKIEAIFHDDKETSFIRNCARK VFNDIKRGRIFEENLINLIGRGGDEALTGFLQYAGCSEQEVNRVLNYRWVNLSSFGDLRL VLRTKLMTSRRVLEREEVPTLIKTLQSKLSRNFTKGVKKILAESINKSAFQSSVASGFIG FCKSMGSKCVRDGKGGFLYIKEVYSGVSACTCEICALKPKIIYCNNSLNKVSQFSKPILW DYFSLVLTNACELGEWVFSTVKEPQKPLVLNNQNFFWAVKPKVVRQIEDQLGMNHVLQSI RRNYPVLFDEHLTPFMNDLQVSRTMDSGRLKFLDVCIALDMMNENLGIISHLLKTRDNSV YIVKQSDCALAHIRQSSYTDWELGLSPQQICTNFKTQLVLSSMVNPLVLSTSCLKSFFWF NEVLELEDDSQIELAELTDFALMVKNQNVSRAMFVEDIAMGYVVSNFEGVRISLSNVMVD GVQLPPQEKAPDIGELFGLKAENVIVGLVVQIDHVRMSTKFKLKRKMVYSFSLECIMDVG EIQNKEVILKVVAVDQSVSGSGGNHMLLDGVSVVASLPLFTGQASFDLAAMLIESNLAGS NDNFLMRNVTLDLGGFSPELSDKYSYRLSGPENQEDPLVLKDGAFYVGGERLSTYKVEFT GDLVVKALGALEDDESVVSMLHQLWPYLKATSQVILFQQEDFTIVHDLYKKQLTKSIESF GEWIEFTNFKVAYSKSLKELVISDTQGSFRLKGVMCRPLASTPQVEDIE
3 Q8AZ57 Q8AZ57_MACHU Pre-glycoprotein polyprotein GP com... GPC Machupo virus (MACV) 496 MGQLISFFQEIPVFLQEALNIALVAVSLIAVIKGIINLYKSGLFQFIFFLLLAGRSCSDG TFKIGLHTEFQSVTLTMQRLLANHSNELPSLCMLNNSFYYMRGGVNTFLIRVSDISVLMK EYDVSIYEPEDLGNCLNKSDSSWAIHWFSNALGHDWLMDPPMLCRNKTKKEGSNIQFNIS KADDARVYGKKIRNGMRHLFRGFHDPCEEGKVCYLTINQCGDPSSFDYCGVNHLSKCQFD HVNTLHFLVRSKTHLNFERSLKAFFSWSLTDSSGKDMPGGYCLEEWMLIAAKMKCFGNTA VAKCNQNHDSEFCDMLRLFDYNKNAIKTLNDESKKEINLLSQTVNALISDNLLMKNKIKE LMSIPYCNYTKFWYVNHTLTGQHTLPRCWLIRNGSYLNTSEFRNDWILESDHLISEMLSK EYAERQGKTPITLVDICFWSTIFFTASLFLHLVGIPTHRHLKGEACPLPHKLDSFGGCRC GKYPRLKKPTIWHKRH
4 Q8AZ68 Q8AZ68_MACHU Nucleoprotein N,NP Machupo virus (MACV) 564 MAHSKEIPSFRWTQSLRRGLSQFTHTVKTDVLKDAKLIADSIDFNQVSQVQRALRKNKRG EEDLNKLRDLNKEVDRLMSMKSIQKNTIFKIGDLGRDELMELASDLEKLKNKIKRTESGP QGLYMGNLSQLQLTKRSEILKTLGFQQQRGAGNGVVRIWDVSDPSKLNNQFGSMPALTIA CMTVQGGETMNSVVQALTSLGLLYTVKYPNLNDLDKLTLEHECLQIVTKDESSINISGYN FSLSAAVKAGASILDGGNMLETIRVTPDNFSSLIKSTLQVKRKEGMFIDEKPGNRNPYEN LLYKLCLSGDGWPYIGSRSQILGRSWDNTSVDLTKKPQVGPRQPEKNGQNLRLANLTEMQ EAVIKEAVKKLDPTNTLWLDIEGPPTDPVELALYQPANKHYIHCFRKPHDEKGFKNGSRH SHGILMQDIEDAMPGVLSYVIGLLPQDMVITTQGSDDIRKLLDIHGRKDLKLVDVKLTSD QARLYDQQIWEKFGHLCKHHNGVVVNKKKREKDSPFKLSSGEPHCALLDCIMYQSVMDGK MVDEEPVALLPLSLLFLPKAAFAL